Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 65366..66009 | Replicon | plasmid 2 |
Accession | NZ_LR890528 | ||
Organism | Klebsiella pneumoniae isolate INF361-sc-2280198 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A5Q9LNG2 |
Locus tag | JMW73_RS25245 | Protein ID | WP_048983057.1 |
Coordinates | 65366..65782 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | R4IT22 |
Locus tag | JMW73_RS25250 | Protein ID | WP_016338373.1 |
Coordinates | 65779..66009 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW73_RS25225 | 61289..62257 | - | 969 | WP_000654811.1 | IS5 family transposase | - |
JMW73_RS25230 | 62286..62522 | - | 237 | Protein_72 | colicin V synthesis protein | - |
JMW73_RS25235 | 62512..63789 | - | 1278 | WP_016338369.1 | HlyD family secretion protein | - |
JMW73_RS25240 | 64448..65325 | + | 878 | Protein_74 | restriction endonuclease | - |
JMW73_RS25245 | 65366..65782 | - | 417 | WP_048983057.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMW73_RS25250 | 65779..66009 | - | 231 | WP_016338373.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
JMW73_RS25255 | 66654..67670 | - | 1017 | WP_001407551.1 | IS5-like element IS5 family transposase | - |
JMW73_RS25260 | 67680..68348 | - | 669 | WP_032249507.1 | response regulator transcription factor | - |
JMW73_RS25265 | 68546..69514 | - | 969 | WP_077265821.1 | IS5 family transposase | - |
JMW73_RS25270 | 69844..70140 | + | 297 | WP_001542733.1 | helix-turn-helix domain-containing protein | - |
JMW73_RS25275 | 70402..70590 | - | 189 | Protein_81 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / qnrB1 / dfrA14 / blaCTX-M-15 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B | - | 1..190324 | 190324 | |
- | inside | IScluster/Tn | - | - | 61289..69514 | 8225 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15022.52 Da Isoelectric Point: 9.2957
>T291297 WP_048983057.1 NZ_LR890528:c65782-65366 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Q9LNG2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Q9LN61 |