Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3847638..3848257 Replicon chromosome
Accession NZ_LR890527
Organism Klebsiella pneumoniae isolate INF361-sc-2280198

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMW73_RS18830 Protein ID WP_002892050.1
Coordinates 3848039..3848257 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMW73_RS18825 Protein ID WP_002892066.1
Coordinates 3847638..3848012 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW73_RS18815 3842790..3843983 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMW73_RS18820 3844006..3847152 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMW73_RS18825 3847638..3848012 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMW73_RS18830 3848039..3848257 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMW73_RS18835 3848420..3848986 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMW73_RS18840 3848958..3849098 - 141 WP_201524398.1 hypothetical protein -
JMW73_RS18845 3849119..3849589 + 471 WP_104159009.1 YlaC family protein -
JMW73_RS18850 3849564..3851015 - 1452 WP_201524399.1 PLP-dependent aminotransferase family protein -
JMW73_RS18855 3851116..3851814 + 699 WP_094310543.1 GNAT family N-acetyltransferase -
JMW73_RS18860 3851811..3851951 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMW73_RS18865 3851951..3852214 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -
JMW73_RS18870 3852356..3852952 + 597 Protein_3698 GNAT family N-acetyltransferase -
JMW73_RS18875 3852949..3853089 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291291 WP_002892050.1 NZ_LR890527:3848039-3848257 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291291 WP_002892066.1 NZ_LR890527:3847638-3848012 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References