Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3847638..3848257 | Replicon | chromosome |
| Accession | NZ_LR890527 | ||
| Organism | Klebsiella pneumoniae isolate INF361-sc-2280198 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | JMW73_RS18830 | Protein ID | WP_002892050.1 |
| Coordinates | 3848039..3848257 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | JMW73_RS18825 | Protein ID | WP_002892066.1 |
| Coordinates | 3847638..3848012 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW73_RS18815 | 3842790..3843983 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| JMW73_RS18820 | 3844006..3847152 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| JMW73_RS18825 | 3847638..3848012 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| JMW73_RS18830 | 3848039..3848257 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
| JMW73_RS18835 | 3848420..3848986 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| JMW73_RS18840 | 3848958..3849098 | - | 141 | WP_201524398.1 | hypothetical protein | - |
| JMW73_RS18845 | 3849119..3849589 | + | 471 | WP_104159009.1 | YlaC family protein | - |
| JMW73_RS18850 | 3849564..3851015 | - | 1452 | WP_201524399.1 | PLP-dependent aminotransferase family protein | - |
| JMW73_RS18855 | 3851116..3851814 | + | 699 | WP_094310543.1 | GNAT family N-acetyltransferase | - |
| JMW73_RS18860 | 3851811..3851951 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| JMW73_RS18865 | 3851951..3852214 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
| JMW73_RS18870 | 3852356..3852952 | + | 597 | Protein_3698 | GNAT family N-acetyltransferase | - |
| JMW73_RS18875 | 3852949..3853089 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T291291 WP_002892050.1 NZ_LR890527:3848039-3848257 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT291291 WP_002892066.1 NZ_LR890527:3847638-3848012 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |