Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-VagC
Location 43276..43925 Replicon plasmid 4
Accession NZ_LR890526
Organism Burkholderia cepacia isolate MINF_4A-sc-2280433

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag ISX57_RS35735 Protein ID WP_027813527.1
Coordinates 43276..43686 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A6P2T8K5
Locus tag ISX57_RS35740 Protein ID WP_027813526.1
Coordinates 43683..43925 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ISX57_RS35690 38307..38597 - 291 WP_027813562.1 hypothetical protein -
ISX57_RS35695 38679..39350 - 672 WP_034176084.1 hypothetical protein -
ISX57_RS35700 39566..39820 - 255 WP_046544062.1 hypothetical protein -
ISX57_RS35705 39830..40060 - 231 WP_027813533.1 hypothetical protein -
ISX57_RS35710 40071..41156 - 1086 WP_027813532.1 hypothetical protein -
ISX57_RS35715 41201..41506 - 306 WP_027813531.1 hypothetical protein -
ISX57_RS35720 41527..42180 - 654 WP_027813530.1 helix-turn-helix domain-containing protein -
ISX57_RS35725 42368..42568 - 201 WP_034176085.1 hypothetical protein -
ISX57_RS35730 42617..42964 - 348 WP_027813528.1 hypothetical protein -
ISX57_RS35735 43276..43686 - 411 WP_027813527.1 type II toxin-antitoxin system VapC family toxin Toxin
ISX57_RS35740 43683..43925 - 243 WP_027813526.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
ISX57_RS35745 44020..45069 - 1050 WP_027813525.1 non-homologous end-joining DNA ligase -
ISX57_RS35750 45472..46143 + 672 WP_027813524.1 AAA family ATPase -
ISX57_RS35755 46143..47108 + 966 WP_027813523.1 ParB/RepB/Spo0J family partition protein -
ISX57_RS35760 47851..48708 + 858 WP_027813522.1 replication initiator protein A -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..114206 114206


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(12-50)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 14869.13 Da        Isoelectric Point: 4.8604

>T291281 WP_027813527.1 NZ_LR890526:c43686-43276 [Burkholderia cepacia]
MTLYLLDTNILSNVIRDPRGACATRIGETPPEQVCTSIIVAAELRFGVWKRGSSTLAQRVEQLLASLTVLPLQPDADRCY
GRLRAELEKQGQLIDANDMLIAAHALAVDAVLVTDNTAEFTRIAGLPVENWLRPAT

Download         Length: 411 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9375.64 Da        Isoelectric Point: 4.6856

>AT291281 WP_027813526.1 NZ_LR890526:c43925-43683 [Burkholderia cepacia]
MPNHDTRHARLFRNGRSQAVRIPREFELPVSEVTIHREGRRLIIEPVEAAPLRELFAQWTPLDEIFPDIEDLPPEPVDIE

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6P2T8K5

References