Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1714244..1714864 | Replicon | chromosome |
| Accession | NZ_LR890524 | ||
| Organism | Burkholderia cepacia isolate MINF_4A-sc-2280433 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | ISX57_RS25190 | Protein ID | WP_049120705.1 |
| Coordinates | 1714244..1714561 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | ISX57_RS25195 | Protein ID | WP_194131478.1 |
| Coordinates | 1714565..1714864 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ISX57_RS25180 | 1710753..1712186 | - | 1434 | WP_006490987.1 | aldehyde dehydrogenase family protein | - |
| ISX57_RS25185 | 1712215..1713855 | - | 1641 | WP_006490980.1 | acetolactate synthase large subunit | - |
| ISX57_RS25190 | 1714244..1714561 | + | 318 | WP_049120705.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ISX57_RS25195 | 1714565..1714864 | + | 300 | WP_194131478.1 | putative addiction module antidote protein | Antitoxin |
| ISX57_RS25200 | 1714913..1716199 | - | 1287 | WP_194131479.1 | DUF445 domain-containing protein | - |
| ISX57_RS25205 | 1716305..1717525 | - | 1221 | WP_194131480.1 | FAD-dependent oxidoreductase | - |
| ISX57_RS25210 | 1717515..1717841 | - | 327 | WP_006496019.1 | non-heme iron oxygenase ferredoxin subunit | - |
| ISX57_RS25215 | 1717877..1718353 | - | 477 | WP_006490977.1 | aromatic-ring-hydroxylating dioxygenase subunit beta | - |
| ISX57_RS25220 | 1718369..1719640 | - | 1272 | WP_194131481.1 | Rieske 2Fe-2S domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11769.46 Da Isoelectric Point: 8.0598
>T291278 WP_049120705.1 NZ_LR890524:1714244-1714561 [Burkholderia cepacia]
MPYSPPAFSIRTTDVFDAWFAGLPDRLAKRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYDVRRGTIWVILL
CGGDQSTQQADIRAAHAMLAHLDME
MPYSPPAFSIRTTDVFDAWFAGLPDRLAKRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYDVRRGTIWVILL
CGGDQSTQQADIRAAHAMLAHLDME
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|