Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1355526..1356172 | Replicon | chromosome |
| Accession | NZ_LR890524 | ||
| Organism | Burkholderia cepacia isolate MINF_4A-sc-2280433 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1V2W4R9 |
| Locus tag | ISX57_RS23650 | Protein ID | WP_062885461.1 |
| Coordinates | 1355526..1355933 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | B4EGU8 |
| Locus tag | ISX57_RS23655 | Protein ID | WP_006491146.1 |
| Coordinates | 1355930..1356172 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ISX57_RS23630 | 1351421..1352002 | - | 582 | WP_006486232.1 | hypothetical protein | - |
| ISX57_RS23635 | 1351999..1352727 | - | 729 | WP_194132106.1 | chemotaxis protein | - |
| ISX57_RS23640 | 1352750..1355125 | - | 2376 | WP_006495105.1 | MCP four helix bundle domain-containing protein | - |
| ISX57_RS23645 | 1355183..1355410 | + | 228 | WP_194132066.1 | hypothetical protein | - |
| ISX57_RS23650 | 1355526..1355933 | - | 408 | WP_062885461.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| ISX57_RS23655 | 1355930..1356172 | - | 243 | WP_006491146.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| ISX57_RS23660 | 1356431..1357114 | + | 684 | WP_194132067.1 | phospholipase | - |
| ISX57_RS23665 | 1357189..1358694 | - | 1506 | WP_006491141.1 | amino acid permease | - |
| ISX57_RS23670 | 1358772..1360178 | - | 1407 | WP_006491136.1 | aspartate ammonia-lyase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14936.05 Da Isoelectric Point: 6.2179
>T291277 WP_062885461.1 NZ_LR890524:c1355933-1355526 [Burkholderia cepacia]
MKFLLDTNAVIAILKGEPAILARLHAWHPADFGIPAIVAHELYYGAYKSQRAAANVARVDALQFEVVSFDTEDAQHAGEI
RAHLIAAGTPIGPYDALIAGQARARQLVLVTHNVREFERVPRLQFEDWLAEPRAD
MKFLLDTNAVIAILKGEPAILARLHAWHPADFGIPAIVAHELYYGAYKSQRAAANVARVDALQFEVVSFDTEDAQHAGEI
RAHLIAAGTPIGPYDALIAGQARARQLVLVTHNVREFERVPRLQFEDWLAEPRAD
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1V2W4R9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | B4EGU8 |