Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 836716..837355 | Replicon | chromosome |
Accession | NZ_LR890524 | ||
Organism | Burkholderia cepacia isolate MINF_4A-sc-2280433 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | ISX57_RS21410 | Protein ID | WP_179148689.1 |
Coordinates | 836939..837355 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A364H554 |
Locus tag | ISX57_RS21405 | Protein ID | WP_006481537.1 |
Coordinates | 836716..836952 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ISX57_RS21390 | 832438..833127 | - | 690 | WP_077214643.1 | hypothetical protein | - |
ISX57_RS21395 | 834309..834986 | + | 678 | WP_077176171.1 | hypothetical protein | - |
ISX57_RS21400 | 834997..836223 | - | 1227 | WP_034202283.1 | acyltransferase | - |
ISX57_RS21405 | 836716..836952 | + | 237 | WP_006481537.1 | DNA-binding protein | Antitoxin |
ISX57_RS21410 | 836939..837355 | + | 417 | WP_179148689.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ISX57_RS21415 | 837615..838511 | + | 897 | WP_006481531.1 | VOC family protein | - |
ISX57_RS21420 | 838521..839414 | + | 894 | WP_048988182.1 | CoA transferase subunit A | - |
ISX57_RS21425 | 839425..840222 | + | 798 | WP_006481539.1 | hypothetical protein | - |
ISX57_RS21430 | 840231..841160 | + | 930 | WP_077021150.1 | enoyl-CoA hydratase | - |
ISX57_RS21435 | 841157..842257 | + | 1101 | WP_034202287.1 | nitronate monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15401.65 Da Isoelectric Point: 7.4038
>T291276 WP_179148689.1 NZ_LR890524:836939-837355 [Burkholderia cepacia]
VFLIDTNVISEIRKGKRTNRGVRAFFRQAEANASPLYLSVVTVAELRRGVDLIRHRGDHSQASALEAWLTMILSGYAPNI
LPVDVETGQMWGHLRVPDPTHELDKLIAATALINDLTVVTRNVDDFARTGVRLLNPFE
VFLIDTNVISEIRKGKRTNRGVRAFFRQAEANASPLYLSVVTVAELRRGVDLIRHRGDHSQASALEAWLTMILSGYAPNI
LPVDVETGQMWGHLRVPDPTHELDKLIAATALINDLTVVTRNVDDFARTGVRLLNPFE
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|