Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 466842..467590 | Replicon | chromosome |
| Accession | NZ_LR890524 | ||
| Organism | Burkholderia cepacia isolate MINF_4A-sc-2280433 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | ISX57_RS19745 | Protein ID | WP_060210861.1 |
| Coordinates | 467078..467590 (+) | Length | 171 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | ISX57_RS19740 | Protein ID | WP_060210862.1 |
| Coordinates | 466842..467081 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ISX57_RS19715 | 462088..462342 | - | 255 | WP_194131877.1 | D-alanyl-D-alanine dipeptidase | - |
| ISX57_RS19720 | 462555..462794 | - | 240 | WP_077189301.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| ISX57_RS19725 | 462863..463546 | - | 684 | WP_060210863.1 | Fe2+-dependent dioxygenase | - |
| ISX57_RS19730 | 463543..464298 | - | 756 | WP_006485843.1 | sel1 repeat family protein | - |
| ISX57_RS19735 | 464302..466545 | - | 2244 | WP_058903292.1 | TonB-dependent siderophore receptor | - |
| ISX57_RS19740 | 466842..467081 | + | 240 | WP_060210862.1 | Arc family DNA-binding protein | Antitoxin |
| ISX57_RS19745 | 467078..467590 | + | 513 | WP_060210861.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| ISX57_RS19750 | 467628..468923 | - | 1296 | WP_006485851.1 | aspartate carbamoyltransferase | - |
| ISX57_RS19755 | 469158..469292 | + | 135 | WP_006485835.1 | entericidin A/B family lipoprotein | - |
| ISX57_RS19760 | 469387..469935 | - | 549 | WP_124632997.1 | permease | - |
| ISX57_RS19765 | 470139..471071 | - | 933 | WP_077189305.1 | DMT family transporter | - |
| ISX57_RS19770 | 471250..472047 | - | 798 | WP_006496182.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 171 a.a. Molecular weight: 18803.81 Da Isoelectric Point: 11.1413
>T291274 WP_060210861.1 NZ_LR890524:467078-467590 [Burkholderia cepacia]
MIPVDTNVMPEPLRREPNAAVIEWLDAQNVETLYLAAISLAELRFGMAALPEGRRRDWLQQSIGQRVLPLFRGRILPFDD
AASRAYASFCARTRAAGNAIAVTDGYIAATAETNGSIVATRDVAPFQALGLRIIDPWAVRFAIAGSFGVPKCKTRRAWRR
VLNRTIRLVP
MIPVDTNVMPEPLRREPNAAVIEWLDAQNVETLYLAAISLAELRFGMAALPEGRRRDWLQQSIGQRVLPLFRGRILPFDD
AASRAYASFCARTRAAGNAIAVTDGYIAATAETNGSIVATRDVAPFQALGLRIIDPWAVRFAIAGSFGVPKCKTRRAWRR
VLNRTIRLVP
Download Length: 513 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|