Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4951589..4952208 Replicon chromosome
Accession NZ_LR890515
Organism Klebsiella pneumoniae isolate INF281-sc-2280206

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMX78_RS24405 Protein ID WP_002892050.1
Coordinates 4951589..4951807 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMX78_RS24410 Protein ID WP_002892066.1
Coordinates 4951834..4952208 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX78_RS24370 4947632..4947895 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
JMX78_RS24375 4947895..4948035 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMX78_RS24380 4948032..4948730 - 699 WP_004177238.1 GNAT family N-acetyltransferase -
JMX78_RS24385 4948831..4950282 + 1452 WP_064162152.1 PLP-dependent aminotransferase family protein -
JMX78_RS24390 4950257..4950727 - 471 WP_002892026.1 YlaC family protein -
JMX78_RS24395 4950748..4950888 + 141 WP_004147370.1 hypothetical protein -
JMX78_RS24400 4950860..4951426 - 567 WP_002892030.1 maltose O-acetyltransferase -
JMX78_RS24405 4951589..4951807 - 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMX78_RS24410 4951834..4952208 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMX78_RS24415 4952694..4955840 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMX78_RS24420 4955863..4957056 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291262 WP_002892050.1 NZ_LR890515:c4951807-4951589 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291262 WP_002892066.1 NZ_LR890515:c4952208-4951834 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References