Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4215961..4216477 | Replicon | chromosome |
Accession | NZ_LR890515 | ||
Organism | Klebsiella pneumoniae isolate INF281-sc-2280206 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | JMX78_RS20920 | Protein ID | WP_040216106.1 |
Coordinates | 4216193..4216477 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | JMX78_RS20915 | Protein ID | WP_064162488.1 |
Coordinates | 4215961..4216203 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX78_RS20900 | 4211989..4212729 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
JMX78_RS20905 | 4212796..4213950 | + | 1155 | WP_064162489.1 | lactonase family protein | - |
JMX78_RS20910 | 4213973..4215883 | + | 1911 | WP_023325426.1 | BglG family transcription antiterminator | - |
JMX78_RS20915 | 4215961..4216203 | + | 243 | WP_064162488.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMX78_RS20920 | 4216193..4216477 | + | 285 | WP_040216106.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX78_RS20925 | 4216481..4216945 | - | 465 | WP_064162487.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMX78_RS20930 | 4217253..4219391 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMX78_RS20935 | 4219748..4220491 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
JMX78_RS20940 | 4220494..4220667 | - | 174 | WP_032425422.1 | hypothetical protein | - |
JMX78_RS20945 | 4220752..4221060 | + | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11097.94 Da Isoelectric Point: 10.4962
>T291260 WP_040216106.1 NZ_LR890515:4216193-4216477 [Klebsiella pneumoniae]
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|