Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 37062..37687 | Replicon | plasmid 2 |
| Accession | NZ_LR890509 | ||
| Organism | Escherichia coli isolate MSB1_9I-sc-2280417 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | JMW57_RS23115 | Protein ID | WP_000911317.1 |
| Coordinates | 37289..37687 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | L4J1D2 |
| Locus tag | JMW57_RS23110 | Protein ID | WP_000450532.1 |
| Coordinates | 37062..37289 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW57_RS23110 | 37062..37289 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| JMW57_RS23115 | 37289..37687 | + | 399 | WP_000911317.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| JMW57_RS23120 | 37696..39885 | - | 2190 | WP_201524628.1 | type IV conjugative transfer system coupling protein TraD | - |
| JMW57_RS23125 | 40137..40868 | - | 732 | WP_123032535.1 | complement resistance protein TraT | - |
| JMW57_RS23130 | 40900..41397 | - | 498 | WP_097731810.1 | entry exclusion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..91228 | 91228 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.14 Da Isoelectric Point: 8.5264
>T291242 WP_000911317.1 NZ_LR890509:37289-37687 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|