Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 2468615..2469210 | Replicon | chromosome |
| Accession | NZ_LR890508 | ||
| Organism | Escherichia coli isolate MSB1_9I-sc-2280417 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9XNP6 |
| Locus tag | JMW57_RS12005 | Protein ID | WP_000239577.1 |
| Coordinates | 2468615..2468965 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | Q8XCF3 |
| Locus tag | JMW57_RS12010 | Protein ID | WP_001223210.1 |
| Coordinates | 2468959..2469210 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW57_RS11985 | 2464061..2465083 | - | 1023 | WP_001313531.1 | ABC transporter permease | - |
| JMW57_RS11990 | 2465097..2466599 | - | 1503 | WP_201524468.1 | sugar ABC transporter ATP-binding protein | - |
| JMW57_RS11995 | 2466739..2467695 | - | 957 | WP_000265913.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| JMW57_RS12000 | 2468005..2468535 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| JMW57_RS12005 | 2468615..2468965 | - | 351 | WP_000239577.1 | endoribonuclease toxin ChpB | Toxin |
| JMW57_RS12010 | 2468959..2469210 | - | 252 | WP_001223210.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| JMW57_RS12015 | 2469422..2469763 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| JMW57_RS12020 | 2469766..2473545 | - | 3780 | WP_000060911.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12492.40 Da Isoelectric Point: 5.5572
>T291230 WP_000239577.1 NZ_LR890508:c2468965-2468615 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|