Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 3701091..3701716 | Replicon | chromosome |
Accession | NZ_LR890500 | ||
Organism | Klebsiella pneumoniae isolate KSB1_5H-sc-2280283 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | JMX76_RS18410 | Protein ID | WP_002882817.1 |
Coordinates | 3701333..3701716 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | JMX76_RS18405 | Protein ID | WP_004150355.1 |
Coordinates | 3701091..3701333 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX76_RS18380 | 3697082..3697681 | + | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
JMX76_RS18385 | 3697675..3698535 | + | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
JMX76_RS18390 | 3698532..3698969 | + | 438 | WP_064162494.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JMX76_RS18395 | 3699014..3699955 | + | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
JMX76_RS18400 | 3699969..3700886 | - | 918 | WP_004181612.1 | alpha/beta hydrolase | - |
JMX76_RS18405 | 3701091..3701333 | + | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JMX76_RS18410 | 3701333..3701716 | + | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMX76_RS18415 | 3701890..3702819 | - | 930 | WP_064162495.1 | formate dehydrogenase accessory protein FdhE | - |
JMX76_RS18420 | 3702816..3703451 | - | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
JMX76_RS18425 | 3703448..3704350 | - | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T291206 WP_002882817.1 NZ_LR890500:3701333-3701716 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |