Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5437735..5438360 | Replicon | chromosome |
Accession | NZ_LR890490 | ||
Organism | Klebsiella pneumoniae isolate INF341-sc-2280155 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | JMX00_RS26395 | Protein ID | WP_040153125.1 |
Coordinates | 5437735..5438118 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | JMX00_RS26400 | Protein ID | WP_004150355.1 |
Coordinates | 5438118..5438360 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX00_RS26380 | 5435101..5436003 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
JMX00_RS26385 | 5436000..5436635 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
JMX00_RS26390 | 5436632..5437561 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
JMX00_RS26395 | 5437735..5438118 | - | 384 | WP_040153125.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMX00_RS26400 | 5438118..5438360 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JMX00_RS26405 | 5438565..5439482 | + | 918 | WP_117079052.1 | alpha/beta hydrolase | - |
JMX00_RS26410 | 5439496..5440437 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
JMX00_RS26415 | 5440482..5440919 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JMX00_RS26420 | 5440916..5441776 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
JMX00_RS26425 | 5441770..5442369 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14324.57 Da Isoelectric Point: 6.7186
>T291183 WP_040153125.1 NZ_LR890490:c5438118-5437735 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQCTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQCTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|