Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4953401..4953917 | Replicon | chromosome |
| Accession | NZ_LR890490 | ||
| Organism | Klebsiella pneumoniae isolate INF341-sc-2280155 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A085DK79 |
| Locus tag | JMX00_RS24065 | Protein ID | WP_009309309.1 |
| Coordinates | 4953401..4953685 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | JMX00_RS24070 | Protein ID | WP_002886901.1 |
| Coordinates | 4953675..4953917 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX00_RS24040 | 4948884..4949192 | - | 309 | WP_004178377.1 | PTS sugar transporter subunit IIB | - |
| JMX00_RS24045 | 4949277..4949450 | + | 174 | WP_032408826.1 | hypothetical protein | - |
| JMX00_RS24050 | 4949453..4950196 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| JMX00_RS24055 | 4950553..4952691 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| JMX00_RS24060 | 4952933..4953397 | + | 465 | WP_004192393.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| JMX00_RS24065 | 4953401..4953685 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMX00_RS24070 | 4953675..4953917 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| JMX00_RS24075 | 4953995..4955905 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
| JMX00_RS24080 | 4955928..4957082 | - | 1155 | WP_032437541.1 | lactonase family protein | - |
| JMX00_RS24085 | 4957149..4957889 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T291181 WP_009309309.1 NZ_LR890490:c4953685-4953401 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085DK79 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |