Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 255882..256621 | Replicon | plasmid 2 |
| Accession | NZ_LR890475 | ||
| Organism | Klebsiella pneumoniae isolate INF358-sc-2280191 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | JMX23_RS26935 | Protein ID | WP_021312536.1 |
| Coordinates | 255882..256367 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | JMX23_RS26940 | Protein ID | WP_049095044.1 |
| Coordinates | 256355..256621 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX23_RS26910 | 251504..251800 | - | 297 | WP_094313394.1 | hydrogenase expression/formation protein HypD | - |
| JMX23_RS26915 | 252127..252504 | + | 378 | WP_032719541.1 | hypothetical protein | - |
| JMX23_RS26920 | 252701..253675 | - | 975 | WP_181961417.1 | Hok/Gef family protein | - |
| JMX23_RS26925 | 254277..254438 | - | 162 | WP_004118124.1 | type I toxin-antitoxin system Hok family toxin | - |
| JMX23_RS26930 | 254510..255589 | + | 1080 | WP_117256484.1 | IS481-like element ISKpn28 family transposase | - |
| JMX23_RS26935 | 255882..256367 | - | 486 | WP_021312536.1 | GNAT family N-acetyltransferase | Toxin |
| JMX23_RS26940 | 256355..256621 | - | 267 | WP_049095044.1 | DUF1778 domain-containing protein | Antitoxin |
| JMX23_RS26945 | 256754..257182 | - | 429 | WP_004901287.1 | GFA family protein | - |
| JMX23_RS26955 | 258891..259895 | + | 1005 | WP_117256483.1 | IS110 family transposase | - |
| JMX23_RS26960 | 260843..261103 | + | 261 | WP_004026352.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..269868 | 269868 | |
| - | inside | IScluster/Tn | - | - | 254510..264882 | 10372 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17608.39 Da Isoelectric Point: 10.3370
>T291154 WP_021312536.1 NZ_LR890475:c256367-255882 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|