Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 209802..210327 | Replicon | plasmid 2 |
| Accession | NZ_LR890475 | ||
| Organism | Klebsiella pneumoniae isolate INF358-sc-2280191 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | J5VBT8 |
| Locus tag | JMX23_RS26720 | Protein ID | WP_004197633.1 |
| Coordinates | 210022..210327 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | R4WC25 |
| Locus tag | JMX23_RS26715 | Protein ID | WP_015632547.1 |
| Coordinates | 209802..210020 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX23_RS26695 | 205250..206095 | + | 846 | WP_023345593.1 | SDR family oxidoreductase | - |
| JMX23_RS26700 | 206208..206636 | + | 429 | WP_023345594.1 | nuclear transport factor 2 family protein | - |
| JMX23_RS26705 | 207014..207982 | + | 969 | WP_064167229.1 | IS110 family transposase | - |
| JMX23_RS26710 | 208150..209523 | - | 1374 | WP_048265005.1 | hypothetical protein | - |
| JMX23_RS26715 | 209802..210020 | + | 219 | WP_015632547.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| JMX23_RS26720 | 210022..210327 | + | 306 | WP_004197633.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| JMX23_RS26725 | 210514..211502 | + | 989 | Protein_208 | hypothetical protein | - |
| JMX23_RS26730 | 211700..212485 | + | 786 | WP_048291886.1 | site-specific integrase | - |
| JMX23_RS26735 | 212807..213112 | - | 306 | WP_126034233.1 | hypothetical protein | - |
| JMX23_RS26740 | 213261..213638 | - | 378 | WP_158672279.1 | DUF1173 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..269868 | 269868 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11585.27 Da Isoelectric Point: 6.4661
>T291153 WP_004197633.1 NZ_LR890475:210022-210327 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MCG5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2L1KT86 |