Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 202085..202728 | Replicon | plasmid 2 |
| Accession | NZ_LR890475 | ||
| Organism | Klebsiella pneumoniae isolate INF358-sc-2280191 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | JMX23_RS26670 | Protein ID | WP_023345587.1 |
| Coordinates | 202085..202501 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | JMX23_RS26675 | Protein ID | WP_023345588.1 |
| Coordinates | 202498..202728 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX23_RS26655 | 197681..198316 | + | 636 | WP_023345584.1 | DUF1349 domain-containing protein | - |
| JMX23_RS26660 | 198706..200580 | + | 1875 | WP_048291888.1 | beta-glucoside-specific PTS transporter subunit IIABC | - |
| JMX23_RS26665 | 200590..201993 | + | 1404 | WP_023345586.1 | glycoside hydrolase family 1 protein | - |
| JMX23_RS26670 | 202085..202501 | - | 417 | WP_023345587.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMX23_RS26675 | 202498..202728 | - | 231 | WP_023345588.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMX23_RS26680 | 203146..203988 | - | 843 | WP_048291887.1 | nitroreductase family protein | - |
| JMX23_RS26685 | 204056..204640 | - | 585 | WP_023345591.1 | TetR/AcrR family transcriptional regulator | - |
| JMX23_RS26690 | 204752..205147 | - | 396 | WP_023345592.1 | helix-turn-helix transcriptional regulator | - |
| JMX23_RS26695 | 205250..206095 | + | 846 | WP_023345593.1 | SDR family oxidoreductase | - |
| JMX23_RS26700 | 206208..206636 | + | 429 | WP_023345594.1 | nuclear transport factor 2 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..269868 | 269868 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15082.55 Da Isoelectric Point: 7.8644
>T291152 WP_023345587.1 NZ_LR890475:c202501-202085 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLMLEDWVN
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLMLEDWVN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|