Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 11119..11762 | Replicon | plasmid 2 |
| Accession | NZ_LR890472 | ||
| Organism | Klebsiella pneumoniae isolate INF168-sc-2280023 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | JMX14_RS25955 | Protein ID | WP_016236302.1 |
| Coordinates | 11346..11762 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | JMX14_RS25950 | Protein ID | WP_001261282.1 |
| Coordinates | 11119..11349 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX14_RS25930 | 6835..7092 | - | 258 | WP_023292103.1 | hypothetical protein | - |
| JMX14_RS25935 | 7696..9150 | + | 1455 | WP_072001611.1 | EAL domain-containing protein | - |
| JMX14_RS25940 | 9768..10199 | - | 432 | WP_174805835.1 | hypothetical protein | - |
| JMX14_RS25945 | 10740..11162 | - | 423 | WP_046624301.1 | hypothetical protein | - |
| JMX14_RS25950 | 11119..11349 | + | 231 | WP_001261282.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMX14_RS25955 | 11346..11762 | + | 417 | WP_016236302.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMX14_RS25960 | 11836..13398 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| JMX14_RS25965 | 13383..14405 | + | 1023 | WP_032439672.1 | helicase UvrD | - |
| JMX14_RS25970 | 14944..15858 | + | 915 | WP_153378766.1 | HNH endonuclease | - |
| JMX14_RS25975 | 16044..16394 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..177028 | 177028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15091.55 Da Isoelectric Point: 7.1084
>T291136 WP_016236302.1 NZ_LR890472:11346-11762 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|