Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4745400..4746103 | Replicon | chromosome |
Accession | NZ_LR890471 | ||
Organism | Klebsiella pneumoniae isolate INF168-sc-2280023 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | JMX14_RS22925 | Protein ID | WP_017880111.1 |
Coordinates | 4745400..4745741 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | JMX14_RS22930 | Protein ID | WP_050131139.1 |
Coordinates | 4745762..4746103 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX14_RS22900 | 4741971..4743098 | + | 1128 | WP_023325431.1 | PAAR domain-containing protein | - |
JMX14_RS22905 | 4743088..4743351 | + | 264 | WP_004192273.1 | hypothetical protein | - |
JMX14_RS22910 | 4743497..4743631 | + | 135 | Protein_4495 | transposase | - |
JMX14_RS22915 | 4743644..4743754 | - | 111 | Protein_4496 | DUF4102 domain-containing protein | - |
JMX14_RS22920 | 4744129..4745136 | - | 1008 | WP_017880110.1 | restriction endonuclease | - |
JMX14_RS22925 | 4745400..4745741 | - | 342 | WP_017880111.1 | TA system toxin CbtA family protein | Toxin |
JMX14_RS22930 | 4745762..4746103 | - | 342 | WP_050131139.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMX14_RS22935 | 4746114..4746656 | - | 543 | WP_017880113.1 | DNA repair protein RadC | - |
JMX14_RS22940 | 4746669..4747112 | - | 444 | WP_017880114.1 | antirestriction protein | - |
JMX14_RS22945 | 4747143..4747964 | - | 822 | WP_017880115.1 | DUF945 domain-containing protein | - |
JMX14_RS22950 | 4748085..4748558 | - | 474 | WP_031280324.1 | hypothetical protein | - |
JMX14_RS22955 | 4748630..4749082 | - | 453 | WP_031280325.1 | hypothetical protein | - |
JMX14_RS22960 | 4749118..4749834 | - | 717 | WP_032417794.1 | WYL domain-containing protein | - |
JMX14_RS22965 | 4750078..4750953 | - | 876 | WP_017880120.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4737844..4772610 | 34766 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12811.73 Da Isoelectric Point: 8.4941
>T291133 WP_017880111.1 NZ_LR890471:c4745741-4745400 [Klebsiella pneumoniae]
MKTLPATNPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDIMRARQATGLLKRNRISAAR
MKTLPATNPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDIMRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|