Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 151638..152239 Replicon plasmid 2
Accession NZ_LR890467
Organism Escherichia coli isolate MSB1_7A-sc-2280394

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag JMW16_RS25420 Protein ID WP_001216034.1
Coordinates 151859..152239 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag JMW16_RS25415 Protein ID WP_001190712.1
Coordinates 151638..151859 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW16_RS25405 148619..149902 - 1284 WP_001617890.1 restriction endonuclease subunit S -
JMW16_RS25410 149899..151455 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
JMW16_RS25415 151638..151859 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW16_RS25420 151859..152239 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW16_RS25425 152244..152423 + 180 WP_001513661.1 hypothetical protein -
JMW16_RS25430 152451..152810 + 360 WP_001513660.1 hypothetical protein -
JMW16_RS25435 152734..153147 + 414 Protein_184 DDE-type integrase/transposase/recombinase -
JMW16_RS25440 153097..153414 - 318 WP_001513659.1 hypothetical protein -
JMW16_RS25445 153642..154658 - 1017 WP_012372828.1 IS5-like element IS5 family transposase -
JMW16_RS25450 154866..156269 + 1404 WP_001373486.1 S-methylmethionine permease -
JMW16_RS25455 156256..157188 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaTEM-1B / blaCTX-M-27 / erm(B) senB 1..160530 160530


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T291120 WP_001216034.1 NZ_LR890467:151859-152239 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT291120 WP_001190712.1 NZ_LR890467:151638-151859 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References