Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 151638..152239 | Replicon | plasmid 2 |
| Accession | NZ_LR890467 | ||
| Organism | Escherichia coli isolate MSB1_7A-sc-2280394 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | JMW16_RS25420 | Protein ID | WP_001216034.1 |
| Coordinates | 151859..152239 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | JMW16_RS25415 | Protein ID | WP_001190712.1 |
| Coordinates | 151638..151859 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW16_RS25405 | 148619..149902 | - | 1284 | WP_001617890.1 | restriction endonuclease subunit S | - |
| JMW16_RS25410 | 149899..151455 | - | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
| JMW16_RS25415 | 151638..151859 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| JMW16_RS25420 | 151859..152239 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| JMW16_RS25425 | 152244..152423 | + | 180 | WP_001513661.1 | hypothetical protein | - |
| JMW16_RS25430 | 152451..152810 | + | 360 | WP_001513660.1 | hypothetical protein | - |
| JMW16_RS25435 | 152734..153147 | + | 414 | Protein_184 | DDE-type integrase/transposase/recombinase | - |
| JMW16_RS25440 | 153097..153414 | - | 318 | WP_001513659.1 | hypothetical protein | - |
| JMW16_RS25445 | 153642..154658 | - | 1017 | WP_012372828.1 | IS5-like element IS5 family transposase | - |
| JMW16_RS25450 | 154866..156269 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
| JMW16_RS25455 | 156256..157188 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaTEM-1B / blaCTX-M-27 / erm(B) | senB | 1..160530 | 160530 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T291120 WP_001216034.1 NZ_LR890467:151859-152239 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |