Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 141966..142491 | Replicon | plasmid 2 |
Accession | NZ_LR890467 | ||
Organism | Escherichia coli isolate MSB1_7A-sc-2280394 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | JMW16_RS25375 | Protein ID | WP_001159868.1 |
Coordinates | 141966..142271 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | JMW16_RS25380 | Protein ID | WP_000813634.1 |
Coordinates | 142273..142491 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW16_RS25360 | 137876..139042 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
JMW16_RS25365 | 139630..140385 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
JMW16_RS25370 | 141159..141965 | - | 807 | WP_000016982.1 | site-specific integrase | - |
JMW16_RS25375 | 141966..142271 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
JMW16_RS25380 | 142273..142491 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
JMW16_RS25385 | 143199..144194 | + | 996 | WP_000246636.1 | hypothetical protein | - |
JMW16_RS25390 | 144198..145130 | + | 933 | WP_000991832.1 | hypothetical protein | - |
JMW16_RS25395 | 145267..145964 | - | 698 | Protein_176 | IS1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaTEM-1B / blaCTX-M-27 / erm(B) | senB | 1..160530 | 160530 | |
- | flank | IS/Tn | - | - | 145267..145770 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T291119 WP_001159868.1 NZ_LR890467:c142271-141966 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|