Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 158540..159210 Replicon plasmid 2
Accession NZ_LR890465
Organism Klebsiella pneumoniae isolate INF079-sc-2280008

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag JMW83_RS26680 Protein ID WP_004213072.1
Coordinates 158540..158983 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag JMW83_RS26685 Protein ID WP_004213073.1
Coordinates 158980..159210 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW83_RS26645 153948..154223 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
JMW83_RS26650 154286..154777 + 492 WP_011251327.1 DM13 domain-containing protein -
JMW83_RS26655 154826..155746 + 921 WP_004213934.1 DUF1471 domain-containing protein -
JMW83_RS26660 155837..156243 + 407 Protein_165 GAF domain-containing protein -
JMW83_RS26665 156758..157396 - 639 Protein_166 response regulator -
JMW83_RS26670 157813..158106 + 294 Protein_167 transposase -
JMW83_RS26675 158110..158526 + 417 Protein_168 restriction endonuclease -
JMW83_RS26680 158540..158983 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
JMW83_RS26685 158980..159210 - 231 WP_004213073.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMW83_RS26690 159818..160951 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
JMW83_RS26695 160967..161260 + 294 WP_004213076.1 hypothetical protein -
JMW83_RS26700 161250..161456 - 207 WP_004213077.1 hypothetical protein -
JMW83_RS26705 161808..162098 + 291 WP_004213078.1 hypothetical protein -
JMW83_RS26710 162088..162987 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..233932 233932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T291086 WP_004213072.1 NZ_LR890465:c158983-158540 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT291086 WP_004213073.1 NZ_LR890465:c159210-158980 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References