Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 80394..81130 | Replicon | plasmid 3 |
Accession | NZ_LR890459 | ||
Organism | Klebsiella pneumoniae isolate KSB1_6G-sc-2280276 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | JMX47_RS28110 | Protein ID | WP_023329018.1 |
Coordinates | 80648..81130 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMX47_RS28105 | Protein ID | WP_003026799.1 |
Coordinates | 80394..80660 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX47_RS28080 | 75682..76890 | + | 1209 | WP_023329016.1 | imidazolonepropionase | - |
JMX47_RS28085 | 76883..77692 | + | 810 | WP_023329017.1 | N-formylglutamate deformylase | - |
JMX47_RS28090 | 77844..77966 | - | 123 | WP_077253309.1 | integrase core domain-containing protein | - |
JMX47_RS28095 | 78136..79104 | + | 969 | WP_003031967.1 | IS110 family transposase | - |
JMX47_RS28100 | 79123..79290 | - | 168 | Protein_89 | transposase | - |
JMX47_RS28105 | 80394..80660 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMX47_RS28110 | 80648..81130 | + | 483 | WP_023329018.1 | GNAT family N-acetyltransferase | Toxin |
JMX47_RS28115 | 81332..82048 | + | 717 | Protein_92 | IS3-like element ISKpn38 family transposase | - |
JMX47_RS28120 | 82330..83193 | - | 864 | WP_020803592.1 | toll/interleukin-1 receptor domain-containing protein | - |
JMX47_RS28125 | 83210..83668 | - | 459 | WP_077252872.1 | hypothetical protein | - |
JMX47_RS28130 | 84075..85070 | + | 996 | WP_023329021.1 | IS110 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..243662 | 243662 | |
- | inside | IScluster/Tn | - | - | 78136..82048 | 3912 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17255.84 Da Isoelectric Point: 7.8840
>T291071 WP_023329018.1 NZ_LR890459:80648-81130 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAEGFYAHHGFKASQTHERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAEGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|