Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 56323..57233 | Replicon | plasmid 3 |
Accession | NZ_LR890459 | ||
Organism | Klebsiella pneumoniae isolate KSB1_6G-sc-2280276 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A2A5MBW7 |
Locus tag | JMX47_RS27985 | Protein ID | WP_023329005.1 |
Coordinates | 56763..57233 (+) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | JMX47_RS27980 | Protein ID | WP_023329004.1 |
Coordinates | 56323..56766 (+) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX47_RS27955 | 52107..52445 | - | 339 | WP_023328998.1 | hypothetical protein | - |
JMX47_RS27960 | 52644..53365 | + | 722 | Protein_61 | DUF969 domain-containing protein | - |
JMX47_RS27965 | 53362..54348 | + | 987 | Protein_62 | DUF979 domain-containing protein | - |
JMX47_RS27970 | 54358..55353 | + | 996 | WP_023329002.1 | DUF2891 domain-containing protein | - |
JMX47_RS27975 | 55514..56201 | + | 688 | Protein_64 | DUF4113 domain-containing protein | - |
JMX47_RS27980 | 56323..56766 | + | 444 | WP_023329004.1 | DUF2384 domain-containing protein | Antitoxin |
JMX47_RS27985 | 56763..57233 | + | 471 | WP_023329005.1 | RES family NAD+ phosphorylase | Toxin |
JMX47_RS27990 | 57344..57603 | - | 260 | Protein_67 | hypothetical protein | - |
JMX47_RS27995 | 58273..59358 | - | 1086 | WP_201545837.1 | IS481 family transposase | - |
JMX47_RS28000 | 59487..61019 | - | 1533 | WP_009310015.1 | IS3-like element ISKpn38 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..243662 | 243662 | |
- | inside | IScluster/Tn | - | - | 58273..64245 | 5972 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17459.70 Da Isoelectric Point: 4.4829
>T291069 WP_023329005.1 NZ_LR890459:56763-57233 [Klebsiella pneumoniae]
VILYRLTKTKNLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPANWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHSDFYGIVQMAQQIPFRFDSRLKPDRK
VILYRLTKTKNLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPANWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHSDFYGIVQMAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16477.82 Da Isoelectric Point: 10.2498
>AT291069 WP_023329004.1 NZ_LR890459:56323-56766 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADSVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAALKWLNEPNRALSWKVPADLIASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADSVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAALKWLNEPNRALSWKVPADLIASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|