Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 203642..204164 | Replicon | plasmid 2 |
Accession | NZ_LR890458 | ||
Organism | Klebsiella pneumoniae isolate KSB1_6G-sc-2280276 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
Locus tag | JMX47_RS27155 | Protein ID | WP_004181778.1 |
Coordinates | 203880..204164 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
Locus tag | JMX47_RS27150 | Protein ID | WP_004181777.1 |
Coordinates | 203642..203890 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX47_RS27130 | 198851..199672 | - | 822 | WP_004181772.1 | hypothetical protein | - |
JMX47_RS27135 | 199734..200087 | - | 354 | WP_004181774.1 | hypothetical protein | - |
JMX47_RS27140 | 200232..201218 | - | 987 | WP_025368599.1 | hypothetical protein | - |
JMX47_RS27145 | 201552..203351 | - | 1800 | WP_004181776.1 | ATP-dependent helicase | - |
JMX47_RS27150 | 203642..203890 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
JMX47_RS27155 | 203880..204164 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX47_RS27165 | 205654..206880 | + | 1227 | WP_040209639.1 | transposase | - |
JMX47_RS27170 | 207151..207375 | - | 225 | Protein_217 | transposase | - |
JMX47_RS27175 | 207454..207882 | - | 429 | WP_077257669.1 | IS200/IS605 family transposase | - |
JMX47_RS27180 | 207918..209105 | + | 1188 | WP_040209642.1 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..311523 | 311523 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T291068 WP_004181778.1 NZ_LR890458:203880-204164 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0S6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0U8 |