Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 45698..46224 | Replicon | plasmid 2 |
Accession | NZ_LR890458 | ||
Organism | Klebsiella pneumoniae isolate KSB1_6G-sc-2280276 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | JMX47_RS26380 | Protein ID | WP_000323025.1 |
Coordinates | 45937..46224 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | J5W3H0 |
Locus tag | JMX47_RS26375 | Protein ID | WP_004196370.1 |
Coordinates | 45698..45937 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX47_RS26345 | 41035..41227 | - | 193 | Protein_52 | MFS transporter | - |
JMX47_RS26350 | 41257..42234 | + | 978 | WP_004196334.1 | chromate resistance protein | - |
JMX47_RS26355 | 42191..43567 | + | 1377 | WP_004196363.1 | chromate efflux transporter | - |
JMX47_RS26360 | 43598..44287 | - | 690 | WP_004196322.1 | hypothetical protein | - |
JMX47_RS26365 | 44301..45038 | - | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
JMX47_RS26370 | 45082..45447 | - | 366 | WP_009651956.1 | hypothetical protein | - |
JMX47_RS26375 | 45698..45937 | + | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
JMX47_RS26380 | 45937..46224 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
JMX47_RS26385 | 46296..46454 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
JMX47_RS26390 | 47060..48034 | + | 975 | WP_004196336.1 | hypothetical protein | - |
JMX47_RS26395 | 48232..48609 | - | 378 | WP_045289277.1 | hypothetical protein | - |
JMX47_RS26400 | 48936..49232 | + | 297 | WP_094313394.1 | hydrogenase expression/formation protein HypD | - |
JMX47_RS26405 | 49301..50368 | + | 1068 | WP_049130554.1 | hypothetical protein | - |
JMX47_RS26410 | 50524..50871 | + | 348 | WP_042935949.1 | hypothetical protein | - |
JMX47_RS26415 | 50950..51183 | + | 234 | WP_042935952.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..311523 | 311523 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T291067 WP_000323025.1 NZ_LR890458:45937-46224 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|