Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 4679675..4680345 | Replicon | chromosome |
| Accession | NZ_LR890457 | ||
| Organism | Klebsiella pneumoniae isolate KSB1_6G-sc-2280276 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A483GLH7 |
| Locus tag | JMX47_RS22995 | Protein ID | WP_023301398.1 |
| Coordinates | 4679675..4680007 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A483GII7 |
| Locus tag | JMX47_RS23000 | Protein ID | WP_023301397.1 |
| Coordinates | 4680028..4680345 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX47_RS22970 | 4674900..4675572 | + | 673 | Protein_4502 | DUF4400 domain-containing protein | - |
| JMX47_RS22975 | 4675583..4676467 | + | 885 | WP_004192285.1 | RES domain-containing protein | - |
| JMX47_RS22980 | 4676666..4676854 | - | 189 | Protein_4504 | transposase | - |
| JMX47_RS22985 | 4676871..4677982 | - | 1112 | Protein_4505 | IS3 family transposase | - |
| JMX47_RS22990 | 4678381..4679280 | - | 900 | WP_077253334.1 | hypothetical protein | - |
| JMX47_RS22995 | 4679675..4680007 | - | 333 | WP_023301398.1 | TA system toxin CbtA family protein | Toxin |
| JMX47_RS23000 | 4680028..4680345 | - | 318 | WP_023301397.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JMX47_RS23005 | 4680364..4680585 | - | 222 | WP_023301396.1 | DUF987 domain-containing protein | - |
| JMX47_RS23010 | 4680594..4681052 | - | 459 | WP_201545789.1 | DNA repair protein RadC | - |
| JMX47_RS23015 | 4681066..4682604 | - | 1539 | WP_022644883.1 | IS66-like element ISKpn24 family transposase | - |
| JMX47_RS23020 | 4682653..4683000 | - | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| JMX47_RS23025 | 4682997..4683401 | - | 405 | WP_007372134.1 | IS66 family insertion sequence hypothetical protein | - |
| JMX47_RS23030 | 4683547..4684005 | - | 459 | WP_023301394.1 | antirestriction protein | - |
| JMX47_RS23035 | 4684091..4684327 | - | 237 | WP_032446575.1 | DUF905 domain-containing protein | - |
| JMX47_RS23040 | 4684405..4684815 | - | 411 | WP_023301393.1 | hypothetical protein | - |
| JMX47_RS23045 | 4684882..4685319 | - | 438 | WP_023301392.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4668745..4713001 | 44256 | |
| - | inside | IScluster/Tn | - | - | 4677066..4683401 | 6335 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12610.65 Da Isoelectric Point: 5.6692
>T291062 WP_023301398.1 NZ_LR890457:c4680007-4679675 [Klebsiella pneumoniae]
MKTLPATTPQTAKLCLTSADTWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIPLADAVNFLVDKYALVRIDRRGL
SWQEQSSYLRLVDTQRTIKVIELWLFGVMM
MKTLPATTPQTAKLCLTSADTWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIPLADAVNFLVDKYALVRIDRRGL
SWQEQSSYLRLVDTQRTIKVIELWLFGVMM
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483GLH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483GII7 |