291062

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 4679675..4680345 Replicon chromosome
Accession NZ_LR890457
Organism Klebsiella pneumoniae isolate KSB1_6G-sc-2280276

Toxin (Protein)


Gene name ypjF Uniprot ID A0A483GLH7
Locus tag JMX47_RS22995 Protein ID WP_023301398.1
Coordinates 4679675..4680007 (-) Length 111 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A483GII7
Locus tag JMX47_RS23000 Protein ID WP_023301397.1
Coordinates 4680028..4680345 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX47_RS22970 4674900..4675572 + 673 Protein_4502 DUF4400 domain-containing protein -
JMX47_RS22975 4675583..4676467 + 885 WP_004192285.1 RES domain-containing protein -
JMX47_RS22980 4676666..4676854 - 189 Protein_4504 transposase -
JMX47_RS22985 4676871..4677982 - 1112 Protein_4505 IS3 family transposase -
JMX47_RS22990 4678381..4679280 - 900 WP_077253334.1 hypothetical protein -
JMX47_RS22995 4679675..4680007 - 333 WP_023301398.1 TA system toxin CbtA family protein Toxin
JMX47_RS23000 4680028..4680345 - 318 WP_023301397.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
JMX47_RS23005 4680364..4680585 - 222 WP_023301396.1 DUF987 domain-containing protein -
JMX47_RS23010 4680594..4681052 - 459 WP_201545789.1 DNA repair protein RadC -
JMX47_RS23015 4681066..4682604 - 1539 WP_022644883.1 IS66-like element ISKpn24 family transposase -
JMX47_RS23020 4682653..4683000 - 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
JMX47_RS23025 4682997..4683401 - 405 WP_007372134.1 IS66 family insertion sequence hypothetical protein -
JMX47_RS23030 4683547..4684005 - 459 WP_023301394.1 antirestriction protein -
JMX47_RS23035 4684091..4684327 - 237 WP_032446575.1 DUF905 domain-containing protein -
JMX47_RS23040 4684405..4684815 - 411 WP_023301393.1 hypothetical protein -
JMX47_RS23045 4684882..4685319 - 438 WP_023301392.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4668745..4713001 44256
- inside IScluster/Tn - - 4677066..4683401 6335


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-101)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12610.65 Da        Isoelectric Point: 5.6692

>T291062 WP_023301398.1 NZ_LR890457:c4680007-4679675 [Klebsiella pneumoniae]
MKTLPATTPQTAKLCLTSADTWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIPLADAVNFLVDKYALVRIDRRGL
SWQEQSSYLRLVDTQRTIKVIELWLFGVMM

Download         Length: 333 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11785.37 Da        Isoelectric Point: 6.6277

>AT291062 WP_023301397.1 NZ_LR890457:c4680345-4680028 [Klebsiella pneumoniae]
MSNITWGLQRDITPCLGSRLVQEGNRLHYLADRASITGKFSDAESLKLDVVFPHFISQMESMLTTGEMNPRHAHCVTLYH
NGFTCEADTLGSSGYVYIAVYLTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A483GLH7

Antitoxin

Source ID Structure
AlphaFold DB A0A483GII7

References