Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 360648..361234 Replicon chromosome
Accession NZ_LR890457
Organism Klebsiella pneumoniae isolate KSB1_6G-sc-2280276

Toxin (Protein)


Gene name doc Uniprot ID A0A486Q6W0
Locus tag JMX47_RS01750 Protein ID WP_020802489.1
Coordinates 360866..361234 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMX47_RS01745 Protein ID WP_004174006.1
Coordinates 360648..360869 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX47_RS01725 356805..357731 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMX47_RS01730 357728..359005 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMX47_RS01735 359002..359769 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMX47_RS01740 359771..360484 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMX47_RS01745 360648..360869 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMX47_RS01750 360866..361234 + 369 WP_020802489.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMX47_RS01755 361507..362823 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMX47_RS01760 362930..363817 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMX47_RS01765 363814..364659 + 846 WP_023328323.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMX47_RS01770 364661..365731 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13542.89 Da        Isoelectric Point: 8.6410

>T291051 WP_020802489.1 NZ_LR890457:360866-361234 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTSGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT291051 WP_004174006.1 NZ_LR890457:360648-360869 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A486Q6W0

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References