Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5033615..5034240 | Replicon | chromosome |
| Accession | NZ_LR890456 | ||
| Organism | Klebsiella pneumoniae isolate INF032-sc-2279918 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | JMV68_RS24405 | Protein ID | WP_002882817.1 |
| Coordinates | 5033615..5033998 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | JMV68_RS24410 | Protein ID | WP_074185945.1 |
| Coordinates | 5033998..5034240 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV68_RS24390 | 5030981..5031883 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| JMV68_RS24395 | 5031880..5032515 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| JMV68_RS24400 | 5032512..5033441 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| JMV68_RS24405 | 5033615..5033998 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMV68_RS24410 | 5033998..5034240 | - | 243 | WP_074185945.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| JMV68_RS24415 | 5034445..5035362 | + | 918 | WP_040223557.1 | alpha/beta hydrolase | - |
| JMV68_RS24420 | 5035376..5036317 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| JMV68_RS24425 | 5036362..5036799 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| JMV68_RS24430 | 5036796..5037656 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| JMV68_RS24435 | 5037650..5038249 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T291050 WP_002882817.1 NZ_LR890456:c5033998-5033615 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|