Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4544678..4545194 | Replicon | chromosome |
Accession | NZ_LR890456 | ||
Organism | Klebsiella pneumoniae isolate INF032-sc-2279918 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | JMV68_RS22065 | Protein ID | WP_040170298.1 |
Coordinates | 4544678..4544962 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | JMV68_RS22070 | Protein ID | WP_002886901.1 |
Coordinates | 4544952..4545194 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV68_RS22040 | 4540095..4540403 | - | 309 | WP_004186703.1 | PTS sugar transporter subunit IIB | - |
JMV68_RS22045 | 4540488..4540661 | + | 174 | WP_004222159.1 | hypothetical protein | - |
JMV68_RS22050 | 4540664..4541407 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
JMV68_RS22055 | 4541764..4543902 | + | 2139 | WP_064148390.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMV68_RS22060 | 4544210..4544674 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMV68_RS22065 | 4544678..4544962 | - | 285 | WP_040170298.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMV68_RS22070 | 4544952..4545194 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMV68_RS22075 | 4545272..4547182 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
JMV68_RS22080 | 4547205..4548359 | - | 1155 | WP_064148391.1 | lactonase family protein | - |
JMV68_RS22085 | 4548426..4549166 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11186.06 Da Isoelectric Point: 10.3787
>T291048 WP_040170298.1 NZ_LR890456:c4544962-4544678 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGEMVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGEMVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|