Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4441566..4442376 | Replicon | chromosome |
Accession | NZ_LR890456 | ||
Organism | Klebsiella pneumoniae isolate INF032-sc-2279918 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | JMV68_RS21645 | Protein ID | WP_004178461.1 |
Coordinates | 4441566..4442099 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | JMV68_RS21650 | Protein ID | WP_002887278.1 |
Coordinates | 4442110..4442376 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV68_RS21640 | 4440397..4441518 | + | 1122 | WP_009309849.1 | cupin domain-containing protein | - |
JMV68_RS21645 | 4441566..4442099 | - | 534 | WP_004178461.1 | GNAT family N-acetyltransferase | Toxin |
JMV68_RS21650 | 4442110..4442376 | - | 267 | WP_002887278.1 | DUF1778 domain-containing protein | Antitoxin |
JMV68_RS21655 | 4442479..4443912 | - | 1434 | WP_023280821.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
JMV68_RS21660 | 4443902..4444585 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
JMV68_RS21665 | 4444758..4446143 | + | 1386 | WP_040238382.1 | efflux transporter outer membrane subunit | - |
JMV68_RS21670 | 4446161..4446505 | + | 345 | WP_002887266.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T291047 WP_004178461.1 NZ_LR890456:c4442099-4441566 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |