Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1734086..1734676 | Replicon | chromosome |
| Accession | NZ_LR890456 | ||
| Organism | Klebsiella pneumoniae isolate INF032-sc-2279918 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | JMV68_RS08375 | Protein ID | WP_021466317.1 |
| Coordinates | 1734344..1734676 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A3S7DDD0 |
| Locus tag | JMV68_RS08370 | Protein ID | WP_000288812.1 |
| Coordinates | 1734086..1734343 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV68_RS08355 | 1731429..1732691 | - | 1263 | WP_200549280.1 | hypothetical protein | - |
| JMV68_RS08360 | 1733076..1733548 | + | 473 | Protein_1632 | hypothetical protein | - |
| JMV68_RS08365 | 1733545..1733751 | + | 207 | WP_020805021.1 | helix-turn-helix domain-containing protein | - |
| JMV68_RS08370 | 1734086..1734343 | + | 258 | WP_000288812.1 | antitoxin | Antitoxin |
| JMV68_RS08375 | 1734344..1734676 | + | 333 | WP_021466317.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| JMV68_RS08385 | 1734999..1736435 | + | 1437 | WP_004151469.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| JMV68_RS08395 | 1736801..1738255 | - | 1455 | WP_004148975.1 | AMP nucleosidase | - |
| JMV68_RS08400 | 1738385..1738630 | - | 246 | WP_004141189.1 | signal transduction protein PmrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1724339..1734676 | 10337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11899.82 Da Isoelectric Point: 10.4722
>T291040 WP_021466317.1 NZ_LR890456:1734344-1734676 [Klebsiella pneumoniae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDAVVNEVLARLDAMLS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDAVVNEVLARLDAMLS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|