Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 45121..45881 | Replicon | plasmid 2 |
| Accession | NZ_LR890447 | ||
| Organism | Klebsiella pneumoniae isolate INF171-sc-2280028 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | JMW80_RS26115 | Protein ID | WP_064177585.1 |
| Coordinates | 45375..45881 (+) | Length | 169 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | JMW80_RS26110 | Protein ID | WP_003026799.1 |
| Coordinates | 45121..45387 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW80_RS26065 | 40806..40904 | - | 99 | WP_004118688.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| JMW80_RS26070 | 40891..41070 | - | 180 | WP_065520248.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| JMW80_RS26075 | 41383..41628 | + | 246 | WP_064177598.1 | hypothetical protein | - |
| JMW80_RS26080 | 41633..42205 | + | 573 | WP_064177597.1 | hypothetical protein | - |
| JMW80_RS26085 | 42236..42730 | + | 495 | WP_064177596.1 | hypothetical protein | - |
| JMW80_RS26090 | 42791..42994 | + | 204 | WP_004213596.1 | hemolysin expression modulator Hha | - |
| JMW80_RS26095 | 43008..43238 | + | 231 | WP_049118762.1 | hypothetical protein | - |
| JMW80_RS26105 | 44691..44945 | + | 255 | WP_044246670.1 | hypothetical protein | - |
| JMW80_RS26110 | 45121..45387 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| JMW80_RS26115 | 45375..45881 | + | 507 | WP_064177585.1 | GNAT family N-acetyltransferase | Toxin |
| JMW80_RS26120 | 46064..47410 | + | 1347 | WP_077255522.1 | ISNCY family transposase | - |
| JMW80_RS26125 | 47459..47857 | + | 399 | WP_032422684.1 | helix-turn-helix domain-containing protein | - |
| JMW80_RS26130 | 48037..49068 | + | 1032 | WP_074194396.1 | IS630-like element ISEc33 family transposase | - |
| JMW80_RS26135 | 49160..49435 | - | 276 | WP_071717249.1 | IS3 family transposase | - |
| JMW80_RS26140 | 49545..50481 | + | 937 | Protein_49 | ISNCY family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..158730 | 158730 | |
| - | inside | IScluster/Tn | - | - | 38059..50502 | 12443 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 169 a.a. Molecular weight: 18119.99 Da Isoelectric Point: 9.6090
>T291036 WP_064177585.1 NZ_LR890447:45375-45881 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLRQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
RLIIGVGK
VGCITAPEPLSSAHQLAEFVSGETVLDEWLRQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
RLIIGVGK
Download Length: 507 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|