Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 4705192..4705895 | Replicon | chromosome |
| Accession | NZ_LR890446 | ||
| Organism | Klebsiella pneumoniae isolate INF171-sc-2280028 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | JMW80_RS22885 | Protein ID | WP_032728834.1 |
| Coordinates | 4705192..4705533 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | JMW80_RS22890 | Protein ID | WP_062729743.1 |
| Coordinates | 4705554..4705895 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW80_RS22870 | 4700677..4702164 | + | 1488 | WP_021441098.1 | hypothetical protein | - |
| JMW80_RS22880 | 4703926..4704933 | - | 1008 | WP_073511318.1 | restriction endonuclease | - |
| JMW80_RS22885 | 4705192..4705533 | - | 342 | WP_032728834.1 | TA system toxin CbtA family protein | Toxin |
| JMW80_RS22890 | 4705554..4705895 | - | 342 | WP_062729743.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JMW80_RS22895 | 4705906..4706445 | - | 540 | WP_062729744.1 | DNA repair protein RadC | - |
| JMW80_RS22900 | 4706458..4706901 | - | 444 | WP_049594271.1 | antirestriction protein | - |
| JMW80_RS22905 | 4706932..4707753 | - | 822 | WP_073511317.1 | DUF945 domain-containing protein | - |
| JMW80_RS22910 | 4707826..4708083 | - | 258 | WP_073511316.1 | DUF905 domain-containing protein | - |
| JMW80_RS22915 | 4708155..4708604 | - | 450 | WP_015699704.1 | hypothetical protein | - |
| JMW80_RS22920 | 4708601..4709053 | - | 453 | WP_062933992.1 | hypothetical protein | - |
| JMW80_RS22925 | 4709090..4709659 | - | 570 | WP_073511315.1 | hypothetical protein | - |
| JMW80_RS22930 | 4709659..4710363 | - | 705 | WP_073511314.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4691679..4735808 | 44129 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12777.71 Da Isoelectric Point: 7.1648
>T291032 WP_032728834.1 NZ_LR890446:c4705533-4705192 [Klebsiella pneumoniae]
MKTLPATTPQAATLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGITLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
MKTLPATTPQAATLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGITLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|