Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 145688..146424 | Replicon | plasmid 2 |
Accession | NZ_LR890435 | ||
Organism | Klebsiella pneumoniae isolate KSB1_9J-sc-2280309 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A2J5Q928 |
Locus tag | JMX02_RS26950 | Protein ID | WP_004098919.1 |
Coordinates | 145942..146424 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | JMX02_RS26945 | Protein ID | WP_032415032.1 |
Coordinates | 145688..145954 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX02_RS26910 | 140868..141730 | + | 863 | Protein_131 | IS3 family transposase | - |
JMX02_RS26915 | 142012..143088 | + | 1077 | WP_000227969.1 | IS110 family transposase | - |
JMX02_RS26920 | 143105..143413 | + | 309 | Protein_133 | DDE-type integrase/transposase/recombinase | - |
JMX02_RS26925 | 143430..143582 | + | 153 | WP_122985329.1 | hypothetical protein | - |
JMX02_RS26930 | 143598..143882 | - | 285 | WP_004187019.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
JMX02_RS26935 | 143872..144120 | - | 249 | WP_004187025.1 | plasmid stabilization protein | - |
JMX02_RS26940 | 144374..145342 | - | 969 | WP_000654811.1 | IS5 family transposase | - |
JMX02_RS26945 | 145688..145954 | + | 267 | WP_032415032.1 | DUF1778 domain-containing protein | Antitoxin |
JMX02_RS26950 | 145942..146424 | + | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
JMX02_RS26955 | 146633..147979 | + | 1347 | WP_077254682.1 | ISNCY family transposase | - |
JMX02_RS26960 | 148038..148832 | + | 795 | WP_004187050.1 | tetratricopeptide repeat protein | - |
JMX02_RS26965 | 148871..150523 | - | 1653 | WP_032415028.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..212029 | 212029 | |
- | inside | IScluster/Tn | - | - | 135353..147979 | 12626 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T291020 WP_004098919.1 NZ_LR890435:145942-146424 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|