Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4800541..4801057 | Replicon | chromosome |
| Accession | NZ_LR890434 | ||
| Organism | Klebsiella pneumoniae isolate KSB1_9J-sc-2280309 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | JMX02_RS23625 | Protein ID | WP_002886902.1 |
| Coordinates | 4800541..4800825 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | JMX02_RS23630 | Protein ID | WP_002886901.1 |
| Coordinates | 4800815..4801057 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX02_RS23600 | 4795957..4796265 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
| JMX02_RS23605 | 4796350..4796523 | + | 174 | WP_032414892.1 | hypothetical protein | - |
| JMX02_RS23610 | 4796526..4797269 | + | 744 | WP_032414890.1 | MurR/RpiR family transcriptional regulator | - |
| JMX02_RS23615 | 4797626..4799764 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| JMX02_RS23620 | 4800073..4800537 | + | 465 | WP_023302390.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| JMX02_RS23625 | 4800541..4800825 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMX02_RS23630 | 4800815..4801057 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| JMX02_RS23635 | 4801135..4803045 | - | 1911 | WP_009486549.1 | BglG family transcription antiterminator | - |
| JMX02_RS23640 | 4803068..4804222 | - | 1155 | WP_023302389.1 | lactonase family protein | - |
| JMX02_RS23645 | 4804289..4805029 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T291016 WP_002886902.1 NZ_LR890434:c4800825-4800541 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |