Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4267384..4268090 | Replicon | chromosome |
Accession | NZ_LR890434 | ||
Organism | Klebsiella pneumoniae isolate KSB1_9J-sc-2280309 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | JMX02_RS21145 | Protein ID | WP_024622903.1 |
Coordinates | 4267722..4268090 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A485WAM6 |
Locus tag | JMX02_RS21140 | Protein ID | WP_023302278.1 |
Coordinates | 4267384..4267701 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX02_RS21095 | 4262525..4263349 | + | 825 | WP_023302271.1 | DUF945 domain-containing protein | - |
JMX02_RS21100 | 4263558..4264268 | + | 711 | WP_023302272.1 | DeoR family transcriptional regulator | - |
JMX02_RS21105 | 4264294..4264830 | + | 537 | WP_023302273.1 | DUF4339 domain-containing protein | - |
JMX02_RS21110 | 4264872..4265309 | + | 438 | WP_023301392.1 | hypothetical protein | - |
JMX02_RS21115 | 4265376..4265786 | + | 411 | WP_023302274.1 | hypothetical protein | - |
JMX02_RS21120 | 4265864..4266100 | + | 237 | WP_032410024.1 | DUF905 domain-containing protein | - |
JMX02_RS21125 | 4266187..4266645 | + | 459 | WP_023302275.1 | antirestriction protein | - |
JMX02_RS21130 | 4266654..4267136 | + | 483 | WP_023302276.1 | RadC family protein | - |
JMX02_RS21135 | 4267145..4267366 | + | 222 | WP_023302277.1 | DUF987 domain-containing protein | - |
JMX02_RS21140 | 4267384..4267701 | + | 318 | WP_023302278.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMX02_RS21145 | 4267722..4268090 | + | 369 | WP_024622903.1 | TA system toxin CbtA family protein | Toxin |
JMX02_RS21150 | 4268087..4268428 | + | 342 | WP_024622904.1 | hypothetical protein | - |
JMX02_RS21155 | 4268551..4271196 | - | 2646 | WP_024622905.1 | LuxR family transcriptional regulator | - |
JMX02_RS21160 | 4271570..4272529 | + | 960 | WP_023302280.1 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13651.82 Da Isoelectric Point: 7.2897
>T291014 WP_024622903.1 NZ_LR890434:4267722-4268090 [Klebsiella pneumoniae]
MKNLPATISQAAKPCLSPVAVWQMLLTHLLEQHYGLMLSDTPFSDEAVIQEHIDAGITLANAVNFLVEKYELVRIDRCGF
SSQVQAPYLTATDILHARKACGLMSRYSYREVSNIVLSRSRI
MKNLPATISQAAKPCLSPVAVWQMLLTHLLEQHYGLMLSDTPFSDEAVIQEHIDAGITLANAVNFLVEKYELVRIDRCGF
SSQVQAPYLTATDILHARKACGLMSRYSYREVSNIVLSRSRI
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|