Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2800013..2800670 | Replicon | chromosome |
| Accession | NZ_LR890426 | ||
| Organism | Klebsiella pneumoniae isolate INF298 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | JMX68_RS13910 | Protein ID | WP_040245400.1 |
| Coordinates | 2800013..2800423 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | JMX68_RS13915 | Protein ID | WP_002916312.1 |
| Coordinates | 2800404..2800670 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX68_RS13890 | 2796013..2797746 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| JMX68_RS13895 | 2797752..2798465 | - | 714 | WP_048290928.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| JMX68_RS13900 | 2798488..2799384 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| JMX68_RS13905 | 2799485..2800006 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
| JMX68_RS13910 | 2800013..2800423 | - | 411 | WP_040245400.1 | protein YgfX | Toxin |
| JMX68_RS13915 | 2800404..2800670 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| JMX68_RS13920 | 2800916..2801899 | + | 984 | WP_032430613.1 | tRNA-modifying protein YgfZ | - |
| JMX68_RS13925 | 2802050..2802709 | - | 660 | WP_048334397.1 | hemolysin III family protein | - |
| JMX68_RS13930 | 2802873..2803184 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| JMX68_RS13935 | 2803234..2803962 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| JMX68_RS13940 | 2804081..2805514 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16035.83 Da Isoelectric Point: 11.4778
>T290990 WP_040245400.1 NZ_LR890426:c2800423-2800013 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDSRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDSRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|