Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4570792..4571602 | Replicon | chromosome |
Accession | NZ_LR890424 | ||
Organism | Klebsiella pneumoniae isolate INF331-sc-2280141 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | JMX49_RS22070 | Protein ID | WP_004178461.1 |
Coordinates | 4570792..4571325 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | JMX49_RS22075 | Protein ID | WP_002887278.1 |
Coordinates | 4571336..4571602 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX49_RS22065 | 4569623..4570744 | + | 1122 | WP_004214138.1 | cupin domain-containing protein | - |
JMX49_RS22070 | 4570792..4571325 | - | 534 | WP_004178461.1 | GNAT family N-acetyltransferase | Toxin |
JMX49_RS22075 | 4571336..4571602 | - | 267 | WP_002887278.1 | DUF1778 domain-containing protein | Antitoxin |
JMX49_RS22080 | 4571705..4573138 | - | 1434 | WP_004214141.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
JMX49_RS22085 | 4573128..4573811 | - | 684 | WP_004214143.1 | copper response regulator transcription factor CusR | - |
JMX49_RS22090 | 4573983..4575368 | + | 1386 | WP_004214145.1 | efflux transporter outer membrane subunit | - |
JMX49_RS22095 | 4575386..4575730 | + | 345 | WP_004214146.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T290978 WP_004178461.1 NZ_LR890424:c4571325-4570792 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |