Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3962833..3963452 | Replicon | chromosome |
| Accession | NZ_LR890424 | ||
| Organism | Klebsiella pneumoniae isolate INF331-sc-2280141 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | JMX49_RS19165 | Protein ID | WP_002892050.1 |
| Coordinates | 3963234..3963452 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | JMX49_RS19160 | Protein ID | WP_002892066.1 |
| Coordinates | 3962833..3963207 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX49_RS19150 | 3957985..3959178 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| JMX49_RS19155 | 3959201..3962347 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| JMX49_RS19160 | 3962833..3963207 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| JMX49_RS19165 | 3963234..3963452 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
| JMX49_RS19170 | 3963611..3964177 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| JMX49_RS19175 | 3964149..3964289 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| JMX49_RS19180 | 3964310..3964780 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| JMX49_RS19185 | 3964755..3966206 | - | 1452 | WP_004213726.1 | PLP-dependent aminotransferase family protein | - |
| JMX49_RS19190 | 3966307..3967005 | + | 699 | WP_004177238.1 | GNAT family N-acetyltransferase | - |
| JMX49_RS19195 | 3967002..3967142 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| JMX49_RS19200 | 3967142..3967405 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3967465..3968511 | 1046 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T290977 WP_002892050.1 NZ_LR890424:3963234-3963452 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT290977 WP_002892066.1 NZ_LR890424:3962833-3963207 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |