Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
Location | 4716343..4717069 | Replicon | chromosome |
Accession | NZ_LR890422 | ||
Organism | Klebsiella pneumoniae isolate INF350-sc-2280174 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | JMW70_RS22905 | Protein ID | WP_107357767.1 |
Coordinates | 4716343..4716684 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | JMW70_RS22910 | Protein ID | WP_107357768.1 |
Coordinates | 4716719..4717069 (-) | Length | 117 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW70_RS22875 | 4711361..4711627 | + | 267 | WP_004178415.1 | hypothetical protein | - |
JMW70_RS22880 | 4711627..4712299 | + | 673 | Protein_4487 | DUF4400 domain-containing protein | - |
JMW70_RS22885 | 4712310..4713194 | + | 885 | WP_004192285.1 | RES domain-containing protein | - |
JMW70_RS22890 | 4713393..4713581 | - | 189 | Protein_4489 | transposase | - |
JMW70_RS22895 | 4713598..4714709 | - | 1112 | Protein_4490 | IS3 family transposase | - |
JMW70_RS22900 | 4715077..4716084 | - | 1008 | WP_107357766.1 | restriction endonuclease | - |
JMW70_RS22905 | 4716343..4716684 | - | 342 | WP_107357767.1 | TA system toxin CbtA family protein | Toxin |
JMW70_RS22910 | 4716719..4717069 | - | 351 | WP_107357768.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMW70_RS22915 | 4717090..4717311 | - | 222 | WP_107357769.1 | DUF987 domain-containing protein | - |
JMW70_RS22920 | 4717327..4717800 | - | 474 | WP_107357770.1 | DNA repair protein RadC | - |
JMW70_RS22925 | 4717871..4718692 | - | 822 | WP_032437350.1 | DUF945 domain-containing protein | - |
JMW70_RS22930 | 4718788..4719465 | - | 678 | WP_107357771.1 | hypothetical protein | - |
JMW70_RS22935 | 4719750..4720643 | - | 894 | WP_107357772.1 | 50S ribosome-binding GTPase | - |
JMW70_RS22940 | 4720742..4721839 | - | 1098 | WP_159175036.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4705472..4743511 | 38039 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12929.02 Da Isoelectric Point: 10.0932
>T290965 WP_107357767.1 NZ_LR890422:c4716684-4716343 [Klebsiella pneumoniae]
MNTLPAINQRAVQTCLSPVVVWQMLLARLLEQHYGLTLNDTPFSDEAVIKRHIEAGITLVDAVNFLLEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAR
MNTLPAINQRAVQTCLSPVVVWQMLLARLLEQHYGLTLNDTPFSDEAVIKRHIEAGITLVDAVNFLLEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Download Length: 117 a.a. Molecular weight: 12974.90 Da Isoelectric Point: 6.6206
>AT290965 WP_107357768.1 NZ_LR890422:c4717069-4716719 [Klebsiella pneumoniae]
MSNKTLTVNDDTAEPWWGLSRNVIPCFGARLVQEGNRLHYLAGRASLTGQIHEADLLHLDQAFPVLLKQMELMLTCGELN
PRHQHCVTLYAKGLTCEADTLGSCGYVYIAIYPTQR
MSNKTLTVNDDTAEPWWGLSRNVIPCFGARLVQEGNRLHYLAGRASLTGQIHEADLLHLDQAFPVLLKQMELMLTCGELN
PRHQHCVTLYAKGLTCEADTLGSCGYVYIAIYPTQR
Download Length: 351 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|