Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 20437..21080 | Replicon | plasmid 3 |
| Accession | NZ_LR890417 | ||
| Organism | Klebsiella pneumoniae isolate INF313-sc-2280106 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | JMX61_RS27385 | Protein ID | WP_001044770.1 |
| Coordinates | 20437..20853 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | JMX61_RS27390 | Protein ID | WP_001261282.1 |
| Coordinates | 20850..21080 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX61_RS27365 | 15806..16156 | + | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
| JMX61_RS27370 | 16342..17250 | - | 909 | WP_032425603.1 | HNH endonuclease | - |
| JMX61_RS27375 | 17794..18816 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| JMX61_RS27380 | 18801..20363 | - | 1563 | WP_009309907.1 | AAA family ATPase | - |
| JMX61_RS27385 | 20437..20853 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMX61_RS27390 | 20850..21080 | - | 231 | WP_001261282.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMX61_RS27395 | 21037..21498 | + | 462 | WP_160866775.1 | hypothetical protein | - |
| JMX61_RS27400 | 21668..21886 | + | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| JMX61_RS27405 | 21888..22193 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | - |
| JMX61_RS27410 | 22380..23384 | + | 1005 | WP_029497484.1 | hypothetical protein | - |
| JMX61_RS27415 | 23582..24361 | + | 780 | WP_029497485.1 | site-specific integrase | - |
| JMX61_RS27420 | 24419..24676 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| JMX61_RS27425 | 24805..24918 | - | 114 | WP_012540012.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..71104 | 71104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T290953 WP_001044770.1 NZ_LR890417:c20853-20437 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |