Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4036040..4036659 Replicon chromosome
Accession NZ_LR890415
Organism Klebsiella pneumoniae isolate INF313-sc-2280106

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMX61_RS19860 Protein ID WP_002892050.1
Coordinates 4036441..4036659 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMX61_RS19855 Protein ID WP_002892066.1
Coordinates 4036040..4036414 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX61_RS19845 4031192..4032385 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMX61_RS19850 4032408..4035554 + 3147 WP_004147373.1 multidrug efflux RND transporter permease subunit -
JMX61_RS19855 4036040..4036414 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMX61_RS19860 4036441..4036659 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMX61_RS19865 4036818..4037384 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMX61_RS19870 4037356..4037496 - 141 WP_004147370.1 hypothetical protein -
JMX61_RS19875 4037517..4037987 + 471 WP_002892026.1 YlaC family protein -
JMX61_RS19880 4037962..4039413 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
JMX61_RS19885 4039514..4040212 + 699 WP_040220001.1 GNAT family N-acetyltransferase -
JMX61_RS19890 4040209..4040349 - 141 WP_040219999.1 type B 50S ribosomal protein L36 -
JMX61_RS19895 4040349..4040612 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T290947 WP_002892050.1 NZ_LR890415:4036441-4036659 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT290947 WP_002892066.1 NZ_LR890415:4036040-4036414 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References