Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 45039..45682 | Replicon | plasmid 2 |
Accession | NZ_LR890411 | ||
Organism | Escherichia coli isolate MSB2_1A-sc-2280429 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | JMW04_RS23945 | Protein ID | WP_001034044.1 |
Coordinates | 45266..45682 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | JMW04_RS23940 | Protein ID | WP_001261286.1 |
Coordinates | 45039..45269 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW04_RS23925 | 40176..40406 | + | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
JMW04_RS23930 | 40403..40819 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
JMW04_RS23935 | 40864..44658 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
JMW04_RS23940 | 45039..45269 | + | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
JMW04_RS23945 | 45266..45682 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMW04_RS23950 | 45757..47322 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
JMW04_RS23955 | 47307..48329 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
JMW04_RS23960 | 48583..49280 | - | 698 | Protein_55 | IS1 family transposase | - |
JMW04_RS23965 | 49583..50280 | + | 698 | Protein_56 | IS1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(3)-IId / blaTEM-1B | - | 1..52208 | 52208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T290936 WP_001034044.1 NZ_LR890411:45266-45682 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |