Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 40176..40819 Replicon plasmid 2
Accession NZ_LR890411
Organism Escherichia coli isolate MSB2_1A-sc-2280429

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag JMW04_RS23930 Protein ID WP_001034046.1
Coordinates 40403..40819 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag JMW04_RS23925 Protein ID WP_001261278.1
Coordinates 40176..40406 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW04_RS23895 35687..35992 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
JMW04_RS23900 35994..36212 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
JMW04_RS23905 36779..37291 + 513 WP_000151784.1 hypothetical protein -
JMW04_RS23910 37325..38458 - 1134 WP_001542067.1 DUF3800 domain-containing protein -
JMW04_RS23915 38625..39398 - 774 WP_000905949.1 hypothetical protein -
JMW04_RS23920 39411..39911 - 501 WP_001773886.1 hypothetical protein -
JMW04_RS23925 40176..40406 + 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMW04_RS23930 40403..40819 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
JMW04_RS23935 40864..44658 - 3795 WP_001144732.1 hypothetical protein -
JMW04_RS23940 45039..45269 + 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JMW04_RS23945 45266..45682 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(3)-IId / blaTEM-1B - 1..52208 52208


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T290935 WP_001034046.1 NZ_LR890411:40403-40819 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT290935 WP_001261278.1 NZ_LR890411:40176-40406 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References