Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 40176..40819 | Replicon | plasmid 2 |
| Accession | NZ_LR890411 | ||
| Organism | Escherichia coli isolate MSB2_1A-sc-2280429 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | JMW04_RS23930 | Protein ID | WP_001034046.1 |
| Coordinates | 40403..40819 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | JMW04_RS23925 | Protein ID | WP_001261278.1 |
| Coordinates | 40176..40406 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW04_RS23895 | 35687..35992 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | - |
| JMW04_RS23900 | 35994..36212 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| JMW04_RS23905 | 36779..37291 | + | 513 | WP_000151784.1 | hypothetical protein | - |
| JMW04_RS23910 | 37325..38458 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
| JMW04_RS23915 | 38625..39398 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| JMW04_RS23920 | 39411..39911 | - | 501 | WP_001773886.1 | hypothetical protein | - |
| JMW04_RS23925 | 40176..40406 | + | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMW04_RS23930 | 40403..40819 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMW04_RS23935 | 40864..44658 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
| JMW04_RS23940 | 45039..45269 | + | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| JMW04_RS23945 | 45266..45682 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aac(3)-IId / blaTEM-1B | - | 1..52208 | 52208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T290935 WP_001034046.1 NZ_LR890411:40403-40819 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |