Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 35687..36212 | Replicon | plasmid 2 |
| Accession | NZ_LR890411 | ||
| Organism | Escherichia coli isolate MSB2_1A-sc-2280429 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | JMW04_RS23895 | Protein ID | WP_001159868.1 |
| Coordinates | 35687..35992 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | JMW04_RS23900 | Protein ID | WP_000813634.1 |
| Coordinates | 35994..36212 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW04_RS23880 | 31597..32763 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| JMW04_RS23885 | 33351..34106 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| JMW04_RS23890 | 34880..35686 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| JMW04_RS23895 | 35687..35992 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| JMW04_RS23900 | 35994..36212 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| JMW04_RS23905 | 36779..37291 | + | 513 | WP_000151784.1 | hypothetical protein | - |
| JMW04_RS23910 | 37325..38458 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
| JMW04_RS23915 | 38625..39398 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| JMW04_RS23920 | 39411..39911 | - | 501 | WP_001773886.1 | hypothetical protein | - |
| JMW04_RS23925 | 40176..40406 | + | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| JMW04_RS23930 | 40403..40819 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aac(3)-IId / blaTEM-1B | - | 1..52208 | 52208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T290934 WP_001159868.1 NZ_LR890411:c35992-35687 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|