Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4073028..4073646 | Replicon | chromosome |
| Accession | NZ_LR890410 | ||
| Organism | Escherichia coli isolate MSB2_1A-sc-2280429 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | JMW04_RS19320 | Protein ID | WP_001291435.1 |
| Coordinates | 4073028..4073246 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | JMW04_RS19325 | Protein ID | WP_000344800.1 |
| Coordinates | 4073272..4073646 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW04_RS19285 | 4068316..4068888 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| JMW04_RS19290 | 4068919..4069230 | - | 312 | WP_000409908.1 | MGMT family protein | - |
| JMW04_RS19300 | 4069609..4069962 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| JMW04_RS19305 | 4070004..4071554 | - | 1551 | WP_001538392.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| JMW04_RS19310 | 4071718..4072188 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| JMW04_RS19315 | 4072304..4072855 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| JMW04_RS19320 | 4073028..4073246 | - | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| JMW04_RS19325 | 4073272..4073646 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| JMW04_RS19330 | 4074192..4077341 | - | 3150 | WP_001132480.1 | multidrug efflux RND transporter permease subunit | - |
| JMW04_RS19335 | 4077364..4078557 | - | 1194 | WP_001538394.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T290932 WP_001291435.1 NZ_LR890410:c4073246-4073028 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT290932 WP_000344800.1 NZ_LR890410:c4073646-4073272 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |