Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3597562..3598112 Replicon chromosome
Accession NZ_LR890410
Organism Escherichia coli isolate MSB2_1A-sc-2280429

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag JMW04_RS17090 Protein ID WP_001160966.1
Coordinates 3597798..3598112 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag JMW04_RS17085 Protein ID WP_000125568.1
Coordinates 3597562..3597795 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW04_RS17060 3592635..3592922 + 288 WP_000203741.1 ferredoxin-like protein FixX -
JMW04_RS17065 3592981..3594312 + 1332 WP_001183207.1 MFS transporter -
JMW04_RS17070 3594420..3594950 + 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
JMW04_RS17075 3594943..3596805 + 1863 WP_000377109.1 glutathione-regulated potassium-efflux system protein KefC -
JMW04_RS17080 3596997..3597476 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
JMW04_RS17085 3597562..3597795 + 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
JMW04_RS17090 3597798..3598112 + 315 WP_001160966.1 CcdB family protein Toxin
JMW04_RS17095 3598109..3598957 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
JMW04_RS17100 3598964..3599341 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
JMW04_RS17105 3599344..3600165 - 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
JMW04_RS17110 3600162..3601151 - 990 WP_000241225.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
JMW04_RS17115 3601151..3602437 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T290930 WP_001160966.1 NZ_LR890410:3597798-3598112 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT290930 WP_000125568.1 NZ_LR890410:3597562-3597795 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References