Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1529113..1529696 | Replicon | chromosome |
Accession | NZ_LR890410 | ||
Organism | Escherichia coli isolate MSB2_1A-sc-2280429 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1PVD8 |
Locus tag | JMW04_RS07330 | Protein ID | WP_000254749.1 |
Coordinates | 1529113..1529448 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | JMW04_RS07335 | Protein ID | WP_000581937.1 |
Coordinates | 1529448..1529696 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW04_RS07315 | 1524999..1526297 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
JMW04_RS07320 | 1526385..1528022 | - | 1638 | WP_001774030.1 | CTP synthase (glutamine hydrolyzing) | - |
JMW04_RS07325 | 1528250..1529041 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
JMW04_RS07330 | 1529113..1529448 | - | 336 | WP_000254749.1 | endoribonuclease MazF | Toxin |
JMW04_RS07335 | 1529448..1529696 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
JMW04_RS07340 | 1529774..1532008 | - | 2235 | WP_000226797.1 | GTP diphosphokinase | - |
JMW04_RS07345 | 1532056..1533357 | - | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12137.06 Da Isoelectric Point: 8.7218
>T290915 WP_000254749.1 NZ_LR890410:c1529448-1529113 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|