Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 37817..38424 Replicon plasmid 2
Accession NZ_LR890406
Organism Escherichia coli isolate MSB1_7C-sc-2280317

Toxin (Protein)


Gene name doc Uniprot ID B7LIH8
Locus tag JMW09_RS24990 Protein ID WP_000673985.1
Coordinates 37817..38203 (-) Length 129 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID B7LIH9
Locus tag JMW09_RS24995 Protein ID WP_000493532.1
Coordinates 38200..38424 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW09_RS24970 32928..33116 + 189 WP_000744815.1 hypothetical protein -
JMW09_RS24975 33244..34633 + 1390 Protein_38 hypothetical protein -
JMW09_RS24980 34633..35315 + 683 Protein_39 lasso peptide biosynthesis B2 protein -
JMW09_RS24985 35315..37039 + 1725 WP_109866728.1 ABC transporter ATP-binding protein/permease -
JMW09_RS24990 37817..38203 - 387 WP_000673985.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW09_RS24995 38200..38424 - 225 WP_000493532.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW09_RS25000 38709..39506 - 798 WP_021557728.1 IS21-like element IS21 family helper ATPase IstB -
JMW09_RS25005 39506..40678 - 1173 Protein_44 IS21 family transposase -
JMW09_RS25010 40771..41025 + 255 Protein_45 hypothetical protein -
JMW09_RS25015 41091..41300 - 210 WP_024192676.1 hypothetical protein -
JMW09_RS25020 41839..42186 - 348 WP_023144239.1 metalloregulator ArsR/SmtB family transcription factor -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B / tet(A) / aac(3)-IIa / mph(A) / sul1 / qacE / aadA5 senB 1..97983 97983


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(11-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-52)


Sequences

Toxin        


Download         Length: 129 a.a.        Molecular weight: 14370.62 Da        Isoelectric Point: 7.0732

>T290908 WP_000673985.1 NZ_LR890406:c38203-37817 [Escherichia coli]
MKFVSSQEVIEFHDRLISRDGGVAGMPEPGRADAIIHRVLNMYHYEGVTDIMDLAAVYLVAIARGHIFNDANKRTALFVA
QVFLKRNGVHIISSRISFDEMQIIALNAATGEYNWKMVSDHLKAIILN

Download         Length: 387 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8361.39 Da        Isoelectric Point: 5.6713

>AT290908 WP_000493532.1 NZ_LR890406:c38424-38200 [Escherichia coli]
MFTCNYSHARDNLASLLELAVDENQPVEIQRRKGGAAVLVDKDAFERYRKAALDAEFAEIMQSHGTAYTELSKR

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A086V9Y9

Antitoxin

Source ID Structure
AlphaFold DB A0A086V9Y8

References